Lineage for d2hxgb1 (2hxg B:329-498)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2792909Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 2792910Superfamily b.43.2: FucI/AraA C-terminal domain-like [50443] (3 families) (S)
  5. 2792920Family b.43.2.2: AraA C-terminal domain-like [141331] (1 protein)
    C-terminal part of Pfam PF02610
  6. 2792921Protein L-arabinose isomerase AraA [141332] (1 species)
  7. 2792922Species Escherichia coli [TaxId:562] [141333] (2 PDB entries)
    Uniprot P08202 329-498
  8. 2792927Domain d2hxgb1: 2hxg B:329-498 [136845]
    Other proteins in same PDB: d2hxga2, d2hxgb2, d2hxgc2
    automated match to d2ajta1
    complexed with mn

Details for d2hxgb1

PDB Entry: 2hxg (more details), 2.8 Å

PDB Description: crystal structure of mn2+ bound ecai
PDB Compounds: (B:) L-arabinose isomerase

SCOPe Domain Sequences for d2hxgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hxgb1 b.43.2.2 (B:329-498) L-arabinose isomerase AraA {Escherichia coli [TaxId: 562]}
tsfmedytyhfekgndlvlgshmlevcpsiaveekpildvqhlgiggkddparlifntqt
gpaivaslidlgdryrllvncidtvktphslpklpvanalwkaqpdlptaseawilagga
hhtvfshalnlndmrqfaemhdieitvidndtrlpafkdalrwnevyygf

SCOPe Domain Coordinates for d2hxgb1:

Click to download the PDB-style file with coordinates for d2hxgb1.
(The format of our PDB-style files is described here.)

Timeline for d2hxgb1: