Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (9 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (5 proteins) in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain |
Protein DNA polymerase I (Klenow fragment) [56674] (3 species) |
Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [56677] (44 PDB entries) Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462 Uniprot Q45458 298-876 # 88% sequence identity |
Domain d2hvhd2: 2hvh D:469-876 [136807] Other proteins in same PDB: d2hvha1, d2hvha3, d2hvhd1, d2hvhd3 protein/DNA complex; complexed with dct, mn, so4 |
PDB Entry: 2hvh (more details), 2.49 Å
SCOPe Domain Sequences for d2hvhd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hvhd2 e.8.1.1 (D:469-876) DNA polymerase I (Klenow fragment) {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]} eqdrllveleqplssilaemefagvkvdtkrleqmgkelaeqlgtveqriyelagqefni nspkqlgvilfeklqlpvlkktktgystsadvleklapyheivenilhyrqlgklqstyi egllkvvrpatkkvhtifnqaltqtgrlsstepnlqnipirleegrkirqafvpsesdwl ifaadysqielrvlahiaeddnlmeafrrdldihtktamdifqvsedevtpnmrrqakav nygivygisdyglaqnlnisrkeaaefieryfesfpgvkrymenivqeakqkgyvttllh rrrylpditsrnfnvrsfaermamntpiqgsaadiikkamidlnarlkeerlqahlllqv hdelileapkeemerlcrlvpevmeqavtlrvplkvdyhygstwydak
Timeline for d2hvhd2: