Lineage for d2ht0b_ (2ht0 B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1271971Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 1271972Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (3 families) (S)
    dimer of identical subunits
  5. 1271973Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (5 proteins)
    automatically mapped to Pfam PF00216
  6. 1272005Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
    heterodimer of two related subunits
  7. 1272006Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)
  8. 1272008Domain d2ht0b_: 2ht0 B: [136729]
    Other proteins in same PDB: d2ht0a_
    automated match to d1ihfb_
    protein/DNA complex; complexed with cd

Details for d2ht0b_

PDB Entry: 2ht0 (more details), 2 Å

PDB Description: IHF bound to doubly nicked DNA
PDB Compounds: (B:) Integration host factor beta-subunit

SCOPe Domain Sequences for d2ht0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht0b_ a.55.1.1 (B:) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniy

SCOPe Domain Coordinates for d2ht0b_:

Click to download the PDB-style file with coordinates for d2ht0b_.
(The format of our PDB-style files is described here.)

Timeline for d2ht0b_: