Lineage for d2ht0b1 (2ht0 B:1-93)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642646Fold a.55: IHF-like DNA-binding proteins [47728] (1 superfamily)
    core: 4 helices; bundle, partly opened, capped with a beta-sheet
  4. 642647Superfamily a.55.1: IHF-like DNA-binding proteins [47729] (2 families) (S)
    dimer of identical subunits
  5. 642648Family a.55.1.1: Prokaryotic DNA-bending protein [47730] (4 proteins)
  6. 642679Protein Integration host factor beta subunit (IHFB) [88880] (1 species)
    heterodimer of two related subunits
  7. 642680Species Escherichia coli [TaxId:562] [88881] (5 PDB entries)
  8. 642682Domain d2ht0b1: 2ht0 B:1-93 [136729]
    Other proteins in same PDB: d2ht0a1
    automatically matched to d1ihfb_
    complexed with cd

Details for d2ht0b1

PDB Entry: 2ht0 (more details), 2 Å

PDB Description: IHF bound to doubly nicked DNA
PDB Compounds: (B:) Integration host factor beta-subunit

SCOP Domain Sequences for d2ht0b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ht0b1 a.55.1.1 (B:1-93) Integration host factor beta subunit (IHFB) {Escherichia coli [TaxId: 562]}
mtkselierlatqqshipaktvedavkemlehmastlaqgerieirgfgsfslhyraprt
grnpktgdkvelegkyvphfkpgkelrdraniy

SCOP Domain Coordinates for d2ht0b1:

Click to download the PDB-style file with coordinates for d2ht0b1.
(The format of our PDB-style files is described here.)

Timeline for d2ht0b1: