Lineage for d2hmua1 (2hmu A:7-140)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 822195Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)
  6. 822196Protein Ktn bsu222 [75118] (1 species)
  7. 822197Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)
  8. 822200Domain d2hmua1: 2hmu A:7-140 [136613]
    automatically matched to d1lsua_
    complexed with atp; mutant

Details for d2hmua1

PDB Entry: 2hmu (more details), 2.25 Å

PDB Description: diamond-shaped octameric ring structure of an rck domain with atp bound
PDB Compounds: (A:) YuaA protein

SCOP Domain Sequences for d2hmua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmua1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsden

SCOP Domain Coordinates for d2hmua1:

Click to download the PDB-style file with coordinates for d2hmua1.
(The format of our PDB-style files is described here.)

Timeline for d2hmua1: