SCOP 1.73: Domain d2hmua1: 2hmu A:7-140

Lineage for d2hmua1 (2hmu A:7-140)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families)

5. Family c.2.1.9: Potassium channel NAD-binding domain [63944] (4 proteins)

6. Protein Ktn bsu222 [75118] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [75119] (6 PDB entries)

8. Domain d2hmua1: 2hmu A:7-140 [136613]
   automatically matched to d1lsua_
   complexed with atp; mutant

Details for d2hmua1

PDB Entry: 2hmu, 2.25 Å

PDB Description: diamond-shaped octameric ring structure of an rck domain with atp bound

PDB Compounds: (A:) YuaA protein

SCOP Domain Sequences for d2hmua1:

Sequence; same for both SEQRES and ATOM records:

>d2hmua1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]}
kqfaviglgrfggsivkelhrmghevlavdineekvnayasyathavianateenellsl
girnfeyvivaiganiqastlttlllkeldipniwvkaqnyyhhkvlekigadriihpek
dmgvkiaqslsden

Timeline for d2hmua1:

• d2hmua1 is new in SCOP 1.73
  
• d2hmua1 appears in SCOP 1.75
  
• d2hmua1 appears in the current release, SCOPe 2.08, called d2hmua_