Lineage for d2hmpb2 (2hmp B:147-374)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 995076Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 995077Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 995078Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 995079Protein Actin [53073] (6 species)
  7. 995090Species Cow (Bos taurus) [TaxId:9913] [53074] (26 PDB entries)
  8. 995116Domain d2hmpb2: 2hmp B:147-374 [136606]
    automatically matched to d1hlua2
    complexed with 211, atp, edo, spd, sr

Details for d2hmpb2

PDB Entry: 2hmp (more details), 1.9 Å

PDB Description: Uncomplexed actin cleaved with protease ECP32
PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2hmpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmpb2 c.55.1.1 (B:147-374) Actin {Cow (Bos taurus) [TaxId: 9913]}
rttgivldsgdgvthnvpiyegyalphaimrldlagrdltdylmkiltergysfvttaer
eivrdikeklcyvaldfenemataassssleksyelpdgqvitignerfrcpetlfqpsf
igmesagihettynsimkcdidirkdlyannvmsggttmypgiadrmqkeitalapstmk
ikiiapperkysvwiggsilaslstfqqmwitkqeydeagpsivhrkc

SCOPe Domain Coordinates for d2hmpb2:

Click to download the PDB-style file with coordinates for d2hmpb2.
(The format of our PDB-style files is described here.)

Timeline for d2hmpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hmpb1