SCOPe 2.07: Domain d2hmla2: 2hml A:155-446

Lineage for d2hmla2 (2hml A:155-446)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (7 proteins)
   Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, C-domain [55970] (5 species)

7. Species Pseudomonas sp. [TaxId:306] [255217] (3 PDB entries)

8. Domain d2hmla2: 2hml A:155-446 [136592]
   Other proteins in same PDB: d2hmla1, d2hmlb_
   automated match to d1eg9a2
   complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmla2

PDB Entry: 2hml, 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOPe Domain Sequences for d2hmla2:

Sequence; same for both SEQRES and ATOM records:

>d2hmla2 d.129.3.3 (A:155-446) Naphthalene 1,2-dioxygenase alpha subunit, C-domain {Pseudomonas sp. [TaxId: 306]}
eapplmdylgdaawylepmfkhsgglelvgppgkvvikanwkapaenfvgdayhvgwtha
sslrsgesifsslagnaalppegaglqmtskygsgmgvlwdgysgvhsadlvpelmafgg
akqerlnkeigdvrariyrshlnctvfpnnsmltcsgvfkvwnpidanttevwtyaivek
dmpedlkrrladsvqrtvgpagfwesddndnmetasqngkkyqsrdsdllsnlgfgedvy
gdavypgvvgksaigetsyrgfyrayqahvsssnwaefehasstwhteltkt

Timeline for d2hmla2:

• d2hmla2 first appeared in SCOP 1.73
  
• d2hmla2 appears in SCOPe 2.06
  
• d2hmla2 appears in the current release, SCOPe 2.08