SCOP 1.73: Domain d2hmla1: 2hml A:1-154

Lineage for d2hmla1 (2hml A:1-154)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (2 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Naphthalene 1,2-dioxygenase alpha subunit, N-domain [50034] (2 species)

7. Species Pseudomonas putida [TaxId:303] [50035] (16 PDB entries)

8. Domain d2hmla1: 2hml A:1-154 [136591]
   Other proteins in same PDB: d2hmla2, d2hmlb1
   automatically matched to d1eg9a1
   complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmla1

PDB Entry: 2hml, 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.

PDB Compounds: (A:) Naphthalene 1,2-dioxygenase alpha subunit

SCOP Domain Sequences for d2hmla1:

Sequence; same for both SEQRES and ATOM records:

>d2hmla1 b.33.1.2 (A:1-154) Naphthalene 1,2-dioxygenase alpha subunit, N-domain {Pseudomonas putida [TaxId: 303]}
mnynnkilvsesglsqkhlihgdeelfqhelktifarnwlflthdslipapgdyvtakmg
idevivsrqndgsiraflnvcrhrgktlvsveagnakgfvcsyhgwgfgsngelqsvpfe
kdlygeslnkkclglkevarvesfhgfiygcfdq

Timeline for d2hmla1:

• d2hmla1 is new in SCOP 1.73
  
• d2hmla1 appears in SCOP 1.75
  
• d2hmla1 appears in the current release, SCOPe 2.08