Lineage for d2hmlb1 (2hml B:3-194)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 718640Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 718985Superfamily d.17.4: NTF2-like [54427] (13 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 719127Family d.17.4.4: Ring hydroxylating beta subunit [54438] (4 proteins)
    Pfam PF00866
  6. 719136Protein Naphthalene 1,2-dioxygenase beta subunit [54439] (2 species)
  7. 719137Species Pseudomonas putida [TaxId:303] [54440] (16 PDB entries)
  8. 719148Domain d2hmlb1: 2hml B:3-194 [136593]
    Other proteins in same PDB: d2hmla1, d2hmla2
    automatically matched to d1eg9b_
    complexed with edo, fe, fes, pey, so4; mutant

Details for d2hmlb1

PDB Entry: 2hml (more details), 1.8 Å

PDB Description: crystal structure of the naphthalene 1,2-dioxygenase f352v mutant bound to phenanthrene.
PDB Compounds: (B:) Naphthalene 1,2-dioxygenase beta subunit

SCOP Domain Sequences for d2hmlb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmlb1 d.17.4.4 (B:3-194) Naphthalene 1,2-dioxygenase beta subunit {Pseudomonas putida [TaxId: 303]}
iniqedklvsahdaeeilrffnchdsalqqeattlltqeahlldiqayrawlehcvgsev
qyqvisrelraaserryklneamnvynenfqqlkvrvehqldpqnwgnspklrftrfitn
vqaamdvndkellhirsnvilhrarrgnqvdvfyaaredkwkrgeggvrklvqrfvdype
rilqthnlmvfl

SCOP Domain Coordinates for d2hmlb1:

Click to download the PDB-style file with coordinates for d2hmlb1.
(The format of our PDB-style files is described here.)

Timeline for d2hmlb1: