Lineage for d2hmfc2 (2hmf C:404-470)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1203810Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1206627Superfamily d.58.18: ACT-like [55021] (14 families) (S)
    regulatory domain linked to a wide range of metabolic enzymes
  5. 1206758Family d.58.18.10: Aspartokinase allosteric domain-like [143390] (1 protein)
    duplication: tandem repeat of two ACT-like domains; similar subunit and oligomeric structures to the VC0802-like family
  6. 1206759Protein Aspartokinase [143391] (3 species)
  7. 1206767Species Methanococcus jannaschii [TaxId:2190] [143392] (1 PDB entry)
    Uniprot Q57991 304-403! Uniprot Q57991 404-470
  8. 1206772Domain d2hmfc2: 2hmf C:404-470 [136580]
    Other proteins in same PDB: d2hmfa1, d2hmfb1, d2hmfc1, d2hmfd1
    automatically matched to 2HMF A:404-470
    complexed with adp, asp, mg

Details for d2hmfc2

PDB Entry: 2hmf (more details), 2.7 Å

PDB Description: structure of a threonine sensitive aspartokinase from methanococcus jannaschii complexed with mg-adp and aspartate
PDB Compounds: (C:) Probable aspartokinase

SCOPe Domain Sequences for d2hmfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hmfc2 d.58.18.10 (C:404-470) Aspartokinase {Methanococcus jannaschii [TaxId: 2190]}
vcvisvvgagmrgakgiagkiftavsesganikmiaqgssevnisfvidekdllncvrkl
hekfiek

SCOPe Domain Coordinates for d2hmfc2:

Click to download the PDB-style file with coordinates for d2hmfc2.
(The format of our PDB-style files is described here.)

Timeline for d2hmfc2: