SCOPe 2.01: Domain d2hlba1: 2hlb A:61-181

Lineage for d2hlba1 (2hlb A:61-181)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.66: Transducin (alpha subunit), insertion domain [47894] (1 superfamily)
   5 helices; folded leaf

4. Superfamily a.66.1: Transducin (alpha subunit), insertion domain [47895] (1 family)
   this domain interrupts the G-protein common fold

5. Family a.66.1.1: Transducin (alpha subunit), insertion domain [47896] (1 protein)

6. Protein Transducin (alpha subunit), insertion domain [47897] (4 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [47899] (24 PDB entries)

8. Domain d2hlba1: 2hlb A:61-181 [136563]
   Other proteins in same PDB: d2hlba2
   automatically matched to d1agra1
   complexed with gdp, so4

Details for d2hlba1

PDB Entry: 2hlb, 2.2 Å

PDB Description: retraction: a structural basis for nucleotide exchange on g-alpha-i subunits and receptor coupling specificity

PDB Compounds: (A:) Guanine nucleotide-binding protein G(i), alpha-1 subunit

SCOPe Domain Sequences for d2hlba1:

Sequence; same for both SEQRES and ATOM records:

>d2hlba1 a.66.1.1 (A:61-181) Transducin (alpha subunit), insertion domain {Norway rat (Rattus norvegicus) [TaxId: 10116]}
yseeeckqykavvysntiqsiiaiiramgrlkidfgdsaraddarqlfvlagaaeegfmt
aelagvikrlwkdsgvqacfnrsreyqlndsaayylndldriaqpnyiptqqdvlrtrvk
t

Timeline for d2hlba1:

• d2hlba1 first appeared in SCOP 1.73
  
• d2hlba1 appears in SCOP 1.75
  
• d2hlba1 does not appear in SCOPe 2.02