Lineage for d2hjka2 (2hjk A:1-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2937912Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)
  8. 2937919Domain d2hjka2: 2hjk A:1-181 [136542]
    Other proteins in same PDB: d2hjka1, d2hjkb_
    automatically matched to d1a1ma2

Details for d2hjka2

PDB Entry: 2hjk (more details), 1.85 Å

PDB Description: Crystal Structure of HLA-B5703 and HIV-1 peptide
PDB Compounds: (A:) HLA class I histocompatibility antigen B-57

SCOPe Domain Sequences for d2hjka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hjka2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghdqsaydg
kdyialnedlsswtaadtaaqiiqrkweaarvaeqlrayleglcvewlrrylengketlq
r

SCOPe Domain Coordinates for d2hjka2:

Click to download the PDB-style file with coordinates for d2hjka2.
(The format of our PDB-style files is described here.)

Timeline for d2hjka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hjka1
View in 3D
Domains from other chains:
(mouse over for more information)
d2hjkb_