Lineage for d2hj9b_ (2hj9 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2143708Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2143709Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2143710Family c.93.1.1: L-arabinose binding protein-like [53823] (18 protein domains)
  6. 2143922Protein Quorum-sensing signal (autoinducer-2) binding protein LuxP [69622] (1 species)
  7. 2143923Species Vibrio harveyi [TaxId:669] [69623] (6 PDB entries)
  8. 2143927Domain d2hj9b_: 2hj9 B: [136539]
    Other proteins in same PDB: d2hj9c1, d2hj9d_
    automated match to d1jx6a_
    complexed with ai2

Details for d2hj9b_

PDB Entry: 2hj9 (more details), 2.34 Å

PDB Description: Crystal structure of the Autoinducer-2-bound form of Vibrio harveyi LuxP complexed with the periplasmic domain of LuxQ
PDB Compounds: (B:) Autoinducer 2-binding periplasmic protein luxP

SCOPe Domain Sequences for d2hj9b_:

Sequence, based on SEQRES records: (download)

>d2hj9b_ c.93.1.1 (B:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrpnadikqqslslmealksksdyliftldttrhrkfveh
vldstntklilqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyf
segyisdvrgdtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacst
dvalgavdalaelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwd
ledkpvptvysgdfeivtkadsperiealkkrafrysdn

Sequence, based on observed residues (ATOM records): (download)

>d2hj9b_ c.93.1.1 (B:) Quorum-sensing signal (autoinducer-2) binding protein LuxP {Vibrio harveyi [TaxId: 669]}
gywgyqefldefpeqrnltnalseavraqpvplskptqrpikisvvypgqqvsdywvrni
asfekrlyklninyqlnqvftrslmealksksdyliftldttrhrkfvehvldstntkli
lqnittpvrewdkhqpflyvgfdhaegsrelatefgkffpkhtyysvlyfsegyisdvrg
dtfihqvnrdnnfelqsayytkatkqsgydaakaslakhpdvdfiyacstdvalgavdal
aelgredimingwgggsaeldaiqkgdlditvmrmnddtgiamaeaikwdledkpvptvy
sgdfeivtkadsperiealkkrafrysdn

SCOPe Domain Coordinates for d2hj9b_:

Click to download the PDB-style file with coordinates for d2hj9b_.
(The format of our PDB-style files is described here.)

Timeline for d2hj9b_: