SCOPe 2.06: Domain d2hitl_: 2hit L:

Lineage for d2hitl_ (2hit L:)

1. Root: SCOPe 2.06

2. Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (9 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (33 PDB entries)

8. Domain d2hitl_: 2hit L: [136531]
   Other proteins in same PDB: d2hith1, d2hith2
   automated match to d1aigl_
   complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pev, pew, po4, u10

Details for d2hitl_

PDB Entry: 2hit, 2.75 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylethanolamine

PDB Compounds: (L:) reaction center protein l chain

SCOPe Domain Sequences for d2hitl_:

Sequence; same for both SEQRES and ATOM records:

>d2hitl_ f.26.1.1 (L:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
allsferkyrvpggtlvggnlfdfwvgpfyvgffgvatfffaalgiiliawsavlqgtwn
pqlisvyppaleyglggaplakgglwqiiticatgafvswalreveicrklgigyhipfa
fafailayltlvlfrpvmmgawgyafpygiwthldwvsntgytygnfhynpahmiaisff
ftnalalalhgalvlsaanpekgkemrtpdhedtffrdlvgysigtlgihrlglllslsa
vffsalcmiitgtiwfdqwvdwwqwwvklpwwanipgging

Timeline for d2hitl_:

• d2hitl_ first appeared in SCOP 1.73, called d2hitl1
  
• d2hitl_ appears in SCOPe 2.05
  
• d2hitl_ appears in SCOPe 2.07
  
• d2hitl_ appears in the current release, SCOPe 2.08