SCOPe 2.01: Domain d2hhwa1: 2hhw A:297-468

Lineage for d2hhwa1 (2hhw A:297-468)

1. Root: SCOPe 2.01

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (15 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (16 proteins)
   contains Pfam PF00929

6. Protein Exonuclease domain of prokaryotic DNA polymerase [53119] (3 species)
   part of Klenow fragment, KF

7. Species Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId:1422] [53122] (42 PDB entries)
   Uniprot Q45458 298-876 # 88% sequence identity ! Uniprot Q5KWC1 299-878 # 99% sequence identity; Geobacillus kaustophilus TaxID:1462

8. Domain d2hhwa1: 2hhw A:297-468 [136516]
   Other proteins in same PDB: d2hhwa2, d2hhwd2
   automatically matched to d1l3sa1
   protein/DNA complex; complexed with 23t, mn, so4, suc

Details for d2hhwa1

PDB Entry: 2hhw, 1.88 Å

PDB Description: ddttp:o6-methyl-guanine pair in the polymerase active site, in the closed conformation

PDB Compounds: (A:) DNA polymerase I

SCOPe Domain Sequences for d2hhwa1:

Sequence; same for both SEQRES and ATOM records:

>d2hhwa1 c.55.3.5 (A:297-468) Exonuclease domain of prokaryotic DNA polymerase {Bacillus stearothermophilus, newly identified strain as yet unnamed [TaxId: 1422]}
akmaftladrvteemladkaalvvevveenyhdapivgiavvnehgrfflrpetaladpq
fvawlgdetkkksmfdskraavalkwkgielcgvsfdlllaaylldpaqgvddvaaaakm
kqyeavrpdeavygkgakravpdepvlaehlvrkaaaiwelerpfldelrrn

Timeline for d2hhwa1:

• d2hhwa1 first appeared in SCOP 1.73
  
• d2hhwa1 appears in SCOP 1.75
  
• d2hhwa1 appears in SCOPe 2.02
  
• d2hhwa1 appears in the current release, SCOPe 2.08