Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) automatically mapped to Pfam PF00124 |
Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
Protein automated matches [190224] (5 species) not a true protein |
Species Rhodobacter sphaeroides [TaxId:1063] [186985] (31 PDB entries) |
Domain d2hhkm_: 2hhk M: [136500] Other proteins in same PDB: d2hhkh1, d2hhkh2 automated match to d1ystm_ complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pgk, pgt, po4, u10 |
PDB Entry: 2hhk (more details), 2.5 Å
SCOPe Domain Sequences for d2hhkm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhkm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]} aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn hg
Timeline for d2hhkm_: