SCOP 1.73: Domain d2hhkm1: 2hhk M:1-302

Lineage for d2hhkm1 (2hhk M:1-302)

1. Root: SCOP 1.73

2. Class f: Membrane and cell surface proteins and peptides [56835] (50 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (2 proteins)
   L and M are probably related to each other

6. Protein M (medium) subunit [81481] (3 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [81479] (50 PDB entries)

8. Domain d2hhkm1: 2hhk M:1-302 [136500]
   Other proteins in same PDB: d2hhkl1
   automatically matched to d2rcrm_
   complexed with bcl, bph, cdl, cl, fe, gol, k, lda, pgk, pgt, po4, u10

Details for d2hhkm1

PDB Entry: 2hhk, 2.5 Å

PDB Description: reaction centre from rhodobacter sphaeroides strain r-26.1 complexed with dibrominated phosphatidylglycerol

PDB Compounds: (M:) reaction center protein m chain

SCOP Domain Sequences for d2hhkm1:

Sequence; same for both SEQRES and ATOM records:

>d2hhkm1 f.26.1.1 (M:1-302) M (medium) subunit {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d2hhkm1:

• d2hhkm1 is new in SCOP 1.73
  
• d2hhkm1 appears in SCOP 1.75
  
• d2hhkm1 appears in the current release, SCOPe 2.08, called d2hhkm_