Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) |
Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins) |
Protein automated matches [190196] (7 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries) |
Domain d2hhjb_: 2hhj B: [136498] automated match to d1t8pa_ complexed with 3pg, dg2, hai |
PDB Entry: 2hhj (more details), 1.5 Å
SCOPe Domain Sequences for d2hhjb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhjb_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai qaaikkvedqgkvk
Timeline for d2hhjb_: