![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest |
![]() | Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (3 families) ![]() |
![]() | Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (3 proteins) |
![]() | Protein Phosphoglycerate mutase [53256] (6 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [110656] (7 PDB entries) |
![]() | Domain d2hhjb1: 2hhj B:3-250 [136498] automatically matched to d1t8pa_ complexed with 3pg, dg2, hai |
PDB Entry: 2hhj (more details), 1.5 Å
SCOP Domain Sequences for d2hhjb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2hhjb1 c.60.1.1 (B:3-250) Phosphoglycerate mutase {Human (Homo sapiens) [TaxId: 9606]} kyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvlnr sihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynvt pppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgkt ilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeaiq aaikkved
Timeline for d2hhjb1: