Lineage for d2hhaa2 (2hha A:509-766)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152172Family c.69.1.24: DPP6 catalytic domain-like [82497] (2 proteins)
    N-terminal domain is a 8-bladed beta-propeller
    automatically mapped to Pfam PF00326
  6. 2152179Protein Dipeptidyl peptidase IV/CD26, C-terminal domain [82498] (2 species)
  7. 2152180Species Human (Homo sapiens) [TaxId:9606] [82499] (55 PDB entries)
    Uniprot P27487 39-776 ! Uniprot P27487 ! Uniprot P27487
  8. 2152225Domain d2hhaa2: 2hha A:509-766 [136471]
    Other proteins in same PDB: d2hhaa1, d2hhab1
    automated match to d1orva2
    complexed with 3tp, na, nag

Details for d2hhaa2

PDB Entry: 2hha (more details), 2.35 Å

PDB Description: the structure of dpp4 in complex with an oxadiazole inhibitor
PDB Compounds: (A:) Hypothetical protein DPP4

SCOPe Domain Sequences for d2hhaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hhaa2 c.69.1.24 (A:509-766) Dipeptidyl peptidase IV/CD26, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
mpskkldfiilnetkfwyqmilpphfdkskkypllldvyagpcsqkadtvfrlnwatyla
steniivasfdgrgsgyqgdkimhainrrlgtfevedqieaarqfskmgfvdnkriaiwg
wsyggyvtsmvlgsgsgvfkcgiavapvsrweyydsvyterymglptpednldhyrnstv
msraenfkqveyllihgtaddnvhfqqsaqiskalvdvgvdfqamwytdedhgiasstah
qhiythmshfikqcfslp

SCOPe Domain Coordinates for d2hhaa2:

Click to download the PDB-style file with coordinates for d2hhaa2.
(The format of our PDB-style files is described here.)

Timeline for d2hhaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hhaa1