SCOPe 2.03: Domain d2hgha3: 2hgh A:161-190

Lineage for d2hgha3 (2hgh A:161-190)

1. Root: SCOPe 2.03

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.37: beta-beta-alpha zinc fingers [57666] (1 superfamily)
   simple fold, consisting of the N-terminal beta-hairpin and C-terminal alpha-helical region; each part provides two zinc-coordinating residues with the observed sequences including C2H2, C2HC and CHHC

4. Superfamily g.37.1: beta-beta-alpha zinc fingers [57667] (8 families)

5. Family g.37.1.1: Classic zinc finger, C2H2 [57668] (31 proteins)

6. Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
   duplication: consists of 6 fingers

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [57694] (5 PDB entries)

8. Domain d2hgha3: 2hgh A:161-190 [136398]
   automatically matched to d1un6b3
   protein/RNA complex; complexed with zn

Details for d2hgha3

PDB Entry: 2hgh

PDB Description: transcription factor iiia zinc fingers 4-6 bound to 5s rrna 55mer (nmr structure)

PDB Compounds: (A:) transcription factor iiia

SCOPe Domain Sequences for d2hgha3:

Sequence; same for both SEQRES and ATOM records:

>d2hgha3 g.37.1.1 (A:161-190) Transcription factor IIIA, TFIIIA {African clawed frog (Xenopus laevis) [TaxId: 8355]}
gypckkddscsfvgktwtlylkhvaechqd

Timeline for d2hgha3:

• d2hgha3 first appeared in SCOP 1.73
  
• d2hgha3 appears in SCOPe 2.02
  
• d2hgha3 appears in SCOPe 2.04
  
• d2hgha3 appears in the current release, SCOPe 2.08