Lineage for d2hgha3 (2hgh A:161-190)

  1. Root: SCOP 1.73
  2. 746751Class g: Small proteins [56992] (85 folds)
  3. 749946Fold g.37: C2H2 and C2HC zinc fingers [57666] (1 superfamily)
    alpha+beta metal(zinc)-bound fold: beta-hairpin + alpha-helix
  4. 749947Superfamily g.37.1: C2H2 and C2HC zinc fingers [57667] (6 families) (S)
  5. 749948Family g.37.1.1: Classic zinc finger, C2H2 [57668] (30 proteins)
  6. 749998Protein Transcription factor IIIA, TFIIIA [57693] (1 species)
    duplication: consists of 6 fingers
  7. 749999Species Xenopus laevis [TaxId:8355] [57694] (4 PDB entries)
  8. 750010Domain d2hgha3: 2hgh A:161-190 [136398]
    automatically matched to d1un6b3
    complexed with zn

Details for d2hgha3

PDB Entry: 2hgh (more details)

PDB Description: transcription factor iiia zinc fingers 4-6 bound to 5s rrna 55mer (nmr structure)
PDB Compounds: (A:) transcription factor iiia

SCOP Domain Sequences for d2hgha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgha3 g.37.1.1 (A:161-190) Transcription factor IIIA, TFIIIA {Xenopus laevis [TaxId: 8355]}
gypckkddscsfvgktwtlylkhvaechqd

SCOP Domain Coordinates for d2hgha3:

Click to download the PDB-style file with coordinates for d2hgha3.
(The format of our PDB-style files is described here.)

Timeline for d2hgha3: