Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily) core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134 |
Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families) |
Family c.58.1.0: automated matches [227157] (1 protein) not a true family |
Protein automated matches [226864] (21 species) not a true protein |
Domain d2haec2: 2hae C:2-154 [136283] Other proteins in same PDB: d2haea1, d2haeb1, d2haec1, d2haed1 automated match to d1vl6a2 complexed with nad, zn |
PDB Entry: 2hae (more details), 3.13 Å
SCOPe Domain Sequences for d2haec2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2haec2 c.58.1.0 (C:2-154) automated matches {Thermotoga maritima [TaxId: 2336]} dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep sfgginledigapkcfrilqrlseemnipvfhd
Timeline for d2haec2: