SCOPe 2.08: Domain d2haea2: 2hae A:2-154

Lineage for d2haea2 (2hae A:2-154)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (6 families)

5. Family c.58.1.0: automated matches [227157] (1 protein)
   not a true family

6. Protein automated matches [226864] (40 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [255205] (1 PDB entry)

8. Domain d2haea2: 2hae A:2-154 [136279]
   Other proteins in same PDB: d2haea1, d2haeb1, d2haec1, d2haed1
   automated match to d1vl6a2
   complexed with nad, zn

Details for d2haea2

PDB Entry: 2hae, 3.13 Å

PDB Description: crystal structure of a putative malic enzyme (malate oxidoreductase)

PDB Compounds: (A:) Malate oxidoreductase

SCOPe Domain Sequences for d2haea2:

Sequence; same for both SEQRES and ATOM records:

>d2haea2 c.58.1.0 (A:2-154) automated matches {Thermotoga maritima [TaxId: 2336]}
dalelhrflkgkirtalpvekvdretlsllytpgvadvaracaedpektyvytsrwntva
vvsdgsavlglgnigpygalpvmegkaflfkafadidafpiclseseeekiisivkslep
sfgginledigapkcfrilqrlseemnipvfhd

Timeline for d2haea2:

• d2haea2 first appeared in SCOP 1.73
  
• d2haea2 appears in SCOPe 2.07