SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2haec1 (2hae C:155-376)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2093723Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 protein domains)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2094007Protein automated matches [227005] (3 species)
    not a true protein
  7. Species Thermotoga maritima [TaxId:2336] [255206] (1 PDB entry)
  8. 2094033Domain d2haec1: 2hae C:155-376 [136282]
    Other proteins in same PDB: d2haea2, d2haeb2, d2haec2, d2haed2
    automated match to d1vl6a1
    complexed with nad, zn

Details for d2haec1

PDB Entry: 2hae (more details), 3.13 Å

PDB Description: Crystal structure of a putative malic enzyme (malate oxidoreductase)
PDB Compounds: (C:) Malate oxidoreductase

SCOPe Domain Sequences for d2haec1:

Sequence, based on SEQRES records: (download)

>d2haec1 c.2.1.7 (C:155-376) automated matches {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyhleiaritnperlsgdletalegadffigvsrgnilkpewikkmsr
kpvifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitk
nmllsaveaiarscepeperiipeafdmkvhlnvytavkgsa

Sequence, based on observed residues (ATOM records): (download)

>d2haec1 c.2.1.7 (C:155-376) automated matches {Thermotoga maritima [TaxId: 2336]}
dqqgtavvvsaaflnalkltekkieevkvvvngigaagynivkflldlgvknvvavdrkg
ilnendpetclneyeiaritnperlsgdletalegadffigvsrgnilkpewikkmsrkp
vifalanpvpeidpelareagafivatgrsdhpnqvnnllafpgimkgavekrskitknm
llsaveaiarscepeperiipeafdmkvhlnvytavkgsa

SCOPe Domain Coordinates for d2haec1:

Click to download the PDB-style file with coordinates for d2haec1.
(The format of our PDB-style files is described here.)

Timeline for d2haec1: