SCOPe 2.05: Domain d2h9gb2: 2h9g B:114-213

Lineage for d2h9gb2 (2h9g B:114-213)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [88575] (179 PDB entries)
   including humanized antibodies (chimeric proteins with human constant domains)
   Uniprot Q6N089 20-243 # 95% sequence identity; natural chimera: antibody heavy chain (Fab HYB3) ! SQ NA # humanized antibody ! Uniprot P01857 # IGHG1_HUMAN Ig gamma-1 chain C region ! SQ NA # engineered antibody

8. Domain d2h9gb2: 2h9g B:114-213 [136258]
   Other proteins in same PDB: d2h9ga1, d2h9ga2, d2h9gb1, d2h9gh1, d2h9gl1, d2h9gl2, d2h9gr1, d2h9gr2, d2h9gr3, d2h9gs1
   automatically matched to d1ngzb2

Details for d2h9gb2

PDB Entry: 2h9g, 2.32 Å

PDB Description: Crystal structure of phage derived Fab BdF1 with human Death Receptor 5 (DR5)

PDB Compounds: (B:) Fab BdF1, heavy chain

SCOPe Domain Sequences for d2h9gb2:

Sequence, based on SEQRES records:

>d2h9gb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Sequence, based on observed residues (ATOM records):

>d2h9gb2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Human (Homo sapiens) [TaxId: 9606]}
astkgpsvfplapssgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysl
ssvvtvpssslgtqtyicnvnhkpsntkvdkkvep

Timeline for d2h9gb2:

• d2h9gb2 first appeared in SCOP 1.73
  
• d2h9gb2 appears in SCOPe 2.04
  
• d2h9gb2 appears in SCOPe 2.06
  
• d2h9gb2 appears in the current release, SCOPe 2.08