Lineage for d2h9cb_ (2h9c B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1282545Fold a.130: Chorismate mutase II [48599] (1 superfamily)
    multihelical; core: 6 helices, bundle
  4. 1282546Superfamily a.130.1: Chorismate mutase II [48600] (5 families) (S)
  5. 1282547Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
    intertwined homodimer of 3-helical subunits
  6. 1282559Protein Salicylate biosynthesis protein PchB [140938] (1 species)
  7. 1282560Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
    Uniprot Q51507 1-94
  8. 1282566Domain d2h9cb_: 2h9c B: [136249]
    automated match to d2h9ca1
    complexed with no3

Details for d2h9cb_

PDB Entry: 2h9c (more details), 2.35 Å

PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa
PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d2h9cb_:

Sequence, based on SEQRES records: (download)

>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqik

Sequence, based on observed residues (ATOM records): (download)

>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfpapervaamlperarwaee
ngldapfveglfaqiihwyiaeqik

SCOPe Domain Coordinates for d2h9cb_:

Click to download the PDB-style file with coordinates for d2h9cb_.
(The format of our PDB-style files is described here.)

Timeline for d2h9cb_: