Class a: All alpha proteins [46456] (284 folds) |
Fold a.130: Chorismate mutase II [48599] (1 superfamily) multihelical; core: 6 helices, bundle |
Superfamily a.130.1: Chorismate mutase II [48600] (5 families) |
Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins) intertwined homodimer of 3-helical subunits |
Protein Salicylate biosynthesis protein PchB [140938] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries) Uniprot Q51507 1-94 |
Domain d2h9cb_: 2h9c B: [136249] automated match to d2h9ca1 complexed with no3 |
PDB Entry: 2h9c (more details), 2.35 Å
SCOPe Domain Sequences for d2h9cb_:
Sequence, based on SEQRES records: (download)
>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]} mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe rarwaeengldapfveglfaqiihwyiaeqik
>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]} mktpedctgladireaidridldivqalgrrmdyvkaasrfpapervaamlperarwaee ngldapfveglfaqiihwyiaeqik
Timeline for d2h9cb_: