SCOPe 2.08: Domain d2h9cb_: 2h9c B:

Lineage for d2h9cb_ (2h9c B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.130: Chorismate mutase II [48599] (1 superfamily)
   multihelical; core: 6 helices, bundle

4. Superfamily a.130.1: Chorismate mutase II [48600] (5 families)

5. Family a.130.1.1: Dimeric chorismate mutase [48601] (4 proteins)
   intertwined homodimer of 3-helical subunits

6. Protein Salicylate biosynthesis protein PchB [140938] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [140939] (2 PDB entries)
   Uniprot Q51507 1-94

8. Domain d2h9cb_: 2h9c B: [136249]
   automated match to d2h9ca1
   complexed with no3

Details for d2h9cb_

PDB Entry: 2h9c, 2.35 Å

PDB Description: native crystal structure of the isochorismate-pyruvate lyase from pseudomonas aeruginosa

PDB Compounds: (B:) Salicylate biosynthesis protein pchB

SCOPe Domain Sequences for d2h9cb_:

Sequence, based on SEQRES records:

>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfkaseaaipapervaamlpe
rarwaeengldapfveglfaqiihwyiaeqik

Sequence, based on observed residues (ATOM records):

>d2h9cb_ a.130.1.1 (B:) Salicylate biosynthesis protein PchB {Pseudomonas aeruginosa [TaxId: 287]}
mktpedctgladireaidridldivqalgrrmdyvkaasrfpapervaamlperarwaee
ngldapfveglfaqiihwyiaeqik

Timeline for d2h9cb_:

• d2h9cb_ first appeared in SCOP 1.73, called d2h9cb1
  
• d2h9cb_ appears in SCOPe 2.07