Lineage for d2h62c_ (2h62 C:)

  1. Root: SCOPe 2.07
  2. 2634415Class g: Small proteins [56992] (98 folds)
  3. 2636873Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 2636874Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 2637112Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)
  6. 2637236Protein automated matches [254536] (1 species)
    not a true protein
  7. 2637237Species Human (Homo sapiens) [TaxId:9606] [255202] (2 PDB entries)
  8. 2637238Domain d2h62c_: 2h62 C: [136179]
    Other proteins in same PDB: d2h62a_, d2h62b_, d2h62d_
    automated match to d3qb4d_

Details for d2h62c_

PDB Entry: 2h62 (more details), 1.85 Å

PDB Description: Crystal structure of a ternary ligand-receptor complex of BMP-2
PDB Compounds: (C:) Bone morphogenetic protein receptor type IA

SCOPe Domain Sequences for d2h62c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h62c_ g.7.1.3 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pflkcycsghcpddainntcitnghcfaiieeddqgettlasgcmkyegsdfqckdspka
qlrrtieccrtnlcnqylqptlpp

SCOPe Domain Coordinates for d2h62c_:

Click to download the PDB-style file with coordinates for d2h62c_.
(The format of our PDB-style files is described here.)

Timeline for d2h62c_: