Lineage for d2h4zb_ (2h4z B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1610508Fold c.60: Phosphoglycerate mutase-like [53253] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 324156; strand 5 is antiparallel to the rest
  4. 1610509Superfamily c.60.1: Phosphoglycerate mutase-like [53254] (4 families) (S)
  5. 1610510Family c.60.1.1: Cofactor-dependent phosphoglycerate mutase [53255] (4 proteins)
  6. 1610562Protein automated matches [190196] (7 species)
    not a true protein
  7. 1610582Species Human (Homo sapiens) [TaxId:9606] [186938] (11 PDB entries)
  8. 1610594Domain d2h4zb_: 2h4z B: [136089]
    automated match to d1t8pa_
    complexed with dg2

Details for d2h4zb_

PDB Entry: 2h4z (more details), 2 Å

PDB Description: human bisphosphoglycerate mutase complexed with 2,3- bisphosphoglycerate
PDB Compounds: (B:) Bisphosphoglycerate mutase

SCOPe Domain Sequences for d2h4zb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4zb_ c.60.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skyklimlrhgegawnkenrfcswvdqklnsegmeearncgkqlkalnfefdlvftsvln
rsihtawlileelgqewvpvesswrlnerhygaliglnreqmalnhgeeqvrlwrrsynv
tpppieeshpyyqeiyndrrykvcdvpldqlprseslkdvlerllpywneriapevlrgk
tilisahgnssrallkhlegisdediinitlptgvpilleldenlravgphqflgdqeai
qaaikkvedqgkvk

SCOPe Domain Coordinates for d2h4zb_:

Click to download the PDB-style file with coordinates for d2h4zb_.
(The format of our PDB-style files is described here.)

Timeline for d2h4zb_: