Lineage for d2h4lx3 (2h4l X:259-367)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2910122Fold c.84: Phosphoglucomutase, first 3 domains [53737] (1 superfamily)
    consists of three similar domains with 3 layers (a/b/a) each; duplication
    core: mixed beta-sheet of 4 strands, order 2134, strand 4 is antiparallel to the rest
  4. 2910123Superfamily c.84.1: Phosphoglucomutase, first 3 domains [53738] (2 families) (S)
  5. 2910124Family c.84.1.1: Phosphoglucomutase, first 3 domains [53739] (6 proteins)
  6. Protein Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain [419009] (1 species)
  7. Species Pseudomonas aeruginosa [TaxId:287] [419481] (12 PDB entries)
  8. 2910206Domain d2h4lx3: 2h4l X:259-367 [136080]
    Other proteins in same PDB: d2h4lx1, d2h4lx4
    automated match to d1p5dx3
    complexed with r1p, zn

Details for d2h4lx3

PDB Entry: 2h4l (more details), 2.4 Å

PDB Description: complex of pmm/pgm with ribose 1-phosphate
PDB Compounds: (X:) Phosphomannomutase/phosphoglucomutase

SCOPe Domain Sequences for d2h4lx3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h4lx3 c.84.1.1 (X:259-367) Phosphomannomutase/phosphoglucomutase, middle and C-terminal domain {Pseudomonas aeruginosa [TaxId: 287]}
ypdrllmlfakdvvsrnpgadiifdvkctrrlialisgyggrpvmwktghslikkkmket
gallagemsghvffkerwfgfddgiysaarlleilsqdqrdsehvfsaf

SCOPe Domain Coordinates for d2h4lx3:

Click to download the PDB-style file with coordinates for d2h4lx3.
(The format of our PDB-style files is described here.)

Timeline for d2h4lx3: