Lineage for d2h40a_ (2h40 A:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. Protein cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx [101439] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [101440] (26 PDB entries)
    Uniprot O76074 534-860
  8. Domain d2h40a_: 2h40 A: [136063]
    automated match to d1rkpa_
    complexed with mg, zn

Details for d2h40a_

PDB Entry: 2h40 (more details), 1.85 Å

PDB Description: Crystal structure of the catalytic domain of unliganded PDE5
PDB Compounds: (A:) cGMP-specific 3',5'-cyclic phosphodiesterase

SCOPe Domain Sequences for d2h40a_:

Sequence, based on SEQRES records: (download)

>d2h40a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqriaelvateffdqgdrerkelnieptdlmnrekknkipsmqvgfidaiclqlyealth
vsedcfplldgcrknrqkwqalaeqq

Sequence, based on observed residues (ATOM records): (download)

>d2h40a_ a.211.1.2 (A:) cGMP-specific 3',5'-cyclic phosphodiesterase pde5a1-Ibmx {Human (Homo sapiens) [TaxId: 9606]}
eetrelqslaaavvpsaqtlkitdfsfsdfelsdletalctirmftdlnlvqnfqmkhev
lcrwilsvkknyrknvayhnwrhafntaqcmfaalkagkiqnkltdleilalliaalshd
ldhrgvnnsyiqrsehplaqlychsimehhhfdqclmilnspgnqilsglsieeykttlk
iikqailatdlalyikrrgeffelirknqfnledphqkelflamlmtacdlsaitkpwpi
qqriaelvateffdqgdrekknkipsmqvgfidaiclqlyealthvsedcfplldgcrkn
rqkwqalaeqq

SCOPe Domain Coordinates for d2h40a_ are not available.

Timeline for d2h40a_: