SCOP 1.73: Domain d2h3va1: 2h3v A:7-107

Lineage for d2h3va1 (2h3v A:7-107)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
   4-5 helices; right-handed superhelix

4. Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families)
   the 5th, C-terminal helix is missing in some of the member structures

5. Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)

6. Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
   topologically similar to one subunit in the interferon-gamma intertwined dimer

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries)

8. Domain d2h3va1: 2h3v A:7-107 [136057]
   automatically matched to d1hiwa_
   complexed with pio

Details for d2h3va1

PDB Entry: 2h3v

PDB Description: structure of the hiv-1 matrix protein bound to di-c8- phosphatidylinositol-(4,5)-bisphosphate

PDB Compounds: (A:) gag polyprotein

SCOP Domain Sequences for d2h3va1:

Sequence; same for both SEQRES and ATOM records:

>d2h3va1 a.61.1.1 (A:7-107) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieee

Timeline for d2h3va1:

• d2h3va1 is new in SCOP 1.73
  
• d2h3va1 appears in SCOP 1.75
  
• d2h3va1 appears in the current release, SCOPe 2.08, called d2h3va_