Lineage for d2h3va1 (2h3v A:7-107)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 643520Fold a.61: Retroviral matrix proteins [47835] (1 superfamily)
    4-5 helices; right-handed superhelix
  4. 643521Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) (S)
    the 5th, C-terminal helix is missing in some of the member structures
  5. 643522Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins)
  6. 643523Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species)
    topologically similar to one subunit in the interferon-gamma intertwined dimer
  7. 643524Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries)
  8. 643534Domain d2h3va1: 2h3v A:7-107 [136057]
    automatically matched to d1hiwa_
    complexed with pio

Details for d2h3va1

PDB Entry: 2h3v (more details)

PDB Description: structure of the hiv-1 matrix protein bound to di-c8- phosphatidylinositol-(4,5)-bisphosphate
PDB Compounds: (A:) gag polyprotein

SCOP Domain Sequences for d2h3va1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h3va1 a.61.1.1 (A:7-107) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]}
vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp
slqtgseelrslyntiavlycvhqridvkdtkealdkieee

SCOP Domain Coordinates for d2h3va1:

Click to download the PDB-style file with coordinates for d2h3va1.
(The format of our PDB-style files is described here.)

Timeline for d2h3va1: