Class a: All alpha proteins [46456] (258 folds) |
Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) the 5th, C-terminal helix is missing in some of the member structures |
Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (2 proteins) |
Protein HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) [47838] (1 species) topologically similar to one subunit in the interferon-gamma intertwined dimer |
Species Human immunodeficiency virus type 1 [TaxId:11676] [47839] (12 PDB entries) |
Domain d2h3va1: 2h3v A:7-107 [136057] automatically matched to d1hiwa_ complexed with pio |
PDB Entry: 2h3v (more details)
SCOP Domain Sequences for d2h3va1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3va1 a.61.1.1 (A:7-107) HIV-1 matrix protein (HIV-1 MA, HIVp17, p17, MA) {Human immunodeficiency virus type 1 [TaxId: 11676]} vlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqilgqlqp slqtgseelrslyntiavlycvhqridvkdtkealdkieee
Timeline for d2h3va1: