![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.61: Retroviral matrix proteins [47835] (1 superfamily) 4-5 helices; right-handed superhelix |
![]() | Superfamily a.61.1: Retroviral matrix proteins [47836] (6 families) ![]() the 5th, C-terminal helix is missing in some of the member structures |
![]() | Family a.61.1.1: Immunodeficiency virus matrix proteins [47837] (3 proteins) automatically mapped to Pfam PF00540 |
![]() | Protein automated matches [228657] (4 species) not a true protein |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [255199] (3 PDB entries) |
![]() | Domain d2h3va_: 2h3v A: [136057] automated match to d1upha_ complexed with pio |
PDB Entry: 2h3v (more details)
SCOPe Domain Sequences for d2h3va_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h3va_ a.61.1.1 (A:) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} garasvlsggeldkwekirlrpggkkqyklkhivwasrelerfavnpglletsegcrqil gqlqpslqtgseelrslyntiavlycvhqridvkdtkealdkieeeqnkskkkaqqaaad tgnnsqvsqny
Timeline for d2h3va_: