Lineage for d2h27a1 (2h27 A:122-190)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1260796Superfamily a.4.13: Sigma3 and sigma4 domains of RNA polymerase sigma factors [88659] (3 families) (S)
  5. 1260831Family a.4.13.2: Sigma4 domain [88665] (5 proteins)
  6. 1260871Protein SigmaE factor (RpoE) [88993] (1 species)
  7. 1260872Species Escherichia coli [TaxId:562] [88994] (2 PDB entries)
  8. 1260875Domain d2h27a1: 2h27 A:122-190 [135993]
    automatically matched to d1or7b1
    protein/DNA complex; complexed with mpd

Details for d2h27a1

PDB Entry: 2h27 (more details), 2.3 Å

PDB Description: crystal structure of escherichia coli sigmae region 4 bound to its-35 element dna
PDB Compounds: (A:) RNA polymerase Sigma E factor

SCOPe Domain Sequences for d2h27a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2h27a1 a.4.13.2 (A:122-190) SigmaE factor (RpoE) {Escherichia coli [TaxId: 562]}
mlseelrqivfrtieslpedlrmaitlreldglsyeeiaaimdcpvgtvrsrifrareai
dnkvqplir

SCOPe Domain Coordinates for d2h27a1:

Click to download the PDB-style file with coordinates for d2h27a1.
(The format of our PDB-style files is described here.)

Timeline for d2h27a1: