Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
Superfamily d.17.3: DsbC/DsbG N-terminal domain-like [54423] (2 families) |
Family d.17.3.1: DsbC/DsbG N-terminal domain-like [54424] (3 proteins) |
Protein Thiol:disulfide interchange protein DsbG, N-terminal domain [110822] (1 species) |
Species Escherichia coli [TaxId:562] [110823] (5 PDB entries) Uniprot P77202 |
Domain d2h0ha2: 2h0h A:2-61 [135934] Other proteins in same PDB: d2h0ha1, d2h0hb1 automated match to d1v58a2 complexed with so4; mutant |
PDB Entry: 2h0h (more details), 1.8 Å
SCOPe Domain Sequences for d2h0ha2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2h0ha2 d.17.3.1 (A:2-61) Thiol:disulfide interchange protein DsbG, N-terminal domain {Escherichia coli [TaxId: 562]} elpapvkaiekqgitiiktfdapggmkgylgkyqdmgvtiyltpdgkhaisgymynekge
Timeline for d2h0ha2: