![]() | Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (52 families) ![]() |
![]() | Family c.66.1.54: Methyltransferase 10 domain [142651] (1 protein) Pfam PF05971; DUF890 |
![]() | Protein Methyltransferase 10 domain containing protein METT10D [142652] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [142653] (1 PDB entry) |
![]() | Domain d2h00c1: 2h00 C:7-254 [135927] automatically matched to 2H00 A:5-254 complexed with cl, dtu, sah |
PDB Entry: 2h00 (more details), 2 Å
SCOP Domain Sequences for d2h00c1:
Sequence, based on SEQRES records: (download)
>d2h00c1 c.66.1.54 (C:7-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdkstl rrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqk tllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimaegg elefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrw alawsfyd
>d2h00c1 c.66.1.54 (C:7-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqtlrrgid igtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqktllmd iiydfcmcnppffggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvp kvtytefcqgrtmrwalawsfyd
Timeline for d2h00c1: