Lineage for d2h00c_ (2h00 C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2129295Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2129296Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (60 families) (S)
  5. 2130491Family c.66.1.54: Methyltransferase 10 domain [142651] (2 protein domains)
    Pfam PF05971; DUF890
  6. 2130495Protein automated matches [190671] (1 species)
    not a true protein
  7. 2130496Species Human (Homo sapiens) [TaxId:9606] [187777] (1 PDB entry)
  8. 2130498Domain d2h00c_: 2h00 C: [135927]
    Other proteins in same PDB: d2h00a1
    automated match to d2h00a1
    complexed with cl, dtu, sah

Details for d2h00c_

PDB Entry: 2h00 (more details), 2 Å

PDB Description: Human methyltransferase 10 domain containing protein
PDB Compounds: (C:) methyltransferase 10 domain containing protein

SCOPe Domain Sequences for d2h00c_:

Sequence, based on SEQRES records: (download)

>d2h00c_ c.66.1.54 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqdsdkstl
rrgidigtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqk
tllmdalkeeseiiydfcmcnppffanqleakgvnsrnprrpppssvntggiteimaegg
elefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvpkvtytefcqgrtmrw
alawsfyd

Sequence, based on observed residues (ATOM records): (download)

>d2h00c_ c.66.1.54 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lnfkdpeavraltctllredfglsidiplerliptvplrlnyihwvedlighqtlrrgid
igtgasciypllgatlngwyflatevddmcfnyakknveqnnlsdlikvvkvpqktllmd
iiydfcmcnppffggelefvkriihdslqlkkrlrwyscmlgkkcslaplkeelriqgvp
kvtytefcqgrtmrwalawsfyd

SCOPe Domain Coordinates for d2h00c_:

Click to download the PDB-style file with coordinates for d2h00c_.
(The format of our PDB-style files is described here.)

Timeline for d2h00c_: