Lineage for d2gysb2 (2gys B:104-217)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1103261Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1109778Superfamily b.1.2: Fibronectin type III [49265] (2 families) (S)
  5. 1109779Family b.1.2.1: Fibronectin type III [49266] (45 proteins)
    Pfam PF00041
  6. 1109787Protein Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors [49289] (1 species)
    duplication: consists of four similar domains; dimerizes by swapping the C-terminal strands of domains 1 and 3
  7. 1109788Species Human (Homo sapiens) [TaxId:9606] [49290] (4 PDB entries)
  8. 1109794Domain d2gysb2: 2gys B:104-217 [135870]
    automatically matched to d1gh7a2

Details for d2gysb2

PDB Entry: 2gys (more details), 2.7 Å

PDB Description: 2.7 a structure of the extracellular domains of the human beta common receptor involved in il-3, il-5, and gm-csf signalling
PDB Compounds: (B:) cytokine receptor common beta chain

SCOPe Domain Sequences for d2gysb2:

Sequence, based on SEQRES records: (download)

>d2gysb2 b.1.2.1 (B:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
tqhvqppeprdlqistdqdhflltwsvalgspqshwlspgdlefevvykrlqdswedaai
llsntsqatlgpehlmpsstyvarvrtrlapgsrlsgrpskwspevcwdsqpgd

Sequence, based on observed residues (ATOM records): (download)

>d2gysb2 b.1.2.1 (B:104-217) Common beta-chain in the GM-CSF, IL-3 and IL-5 receptors {Human (Homo sapiens) [TaxId: 9606]}
tqhvqppeprdlqistdqdhflltwsvalhwlspgdlefevvykrlqdswedaaillsnt
sqatlgpehlmpsstyvarvrtrlapgsrlsgrpskwspevcwdsqpgd

SCOPe Domain Coordinates for d2gysb2:

Click to download the PDB-style file with coordinates for d2gysb2.
(The format of our PDB-style files is described here.)

Timeline for d2gysb2: