Class a: All alpha proteins [46456] (289 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins) Pfam PF02295 |
Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries) |
Domain d2gxba2: 2gxb A:140-198 [135830] Other proteins in same PDB: d2gxba3, d2gxbb3 automated match to d3irrd_ protein/RNA complex; complexed with na |
PDB Entry: 2gxb (more details), 2.25 Å
SCOPe Domain Sequences for d2gxba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gxba2 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} eqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwkia
Timeline for d2gxba2: