SCOPe 2.06: Domain d2gxba2: 2gxb A:140-198

Lineage for d2gxba2 (2gxb A:140-198)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.19: Z-DNA binding domain [46853] (5 proteins)
   Pfam PF02295

6. Protein Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 [46854] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46855] (8 PDB entries)

8. Domain d2gxba2: 2gxb A:140-198 [135830]
   Other proteins in same PDB: d2gxba3, d2gxbb3
   automated match to d3irrd_
   protein/RNA complex; complexed with na

Details for d2gxba2

PDB Entry: 2gxb, 2.25 Å

PDB Description: Crystal Structure of The Za Domain bound to Z-RNA

PDB Compounds: (A:) Double-stranded RNA-specific adenosine deaminase

SCOPe Domain Sequences for d2gxba2:

Sequence; same for both SEQRES and ATOM records:

>d2gxba2 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]}
eqrilkfleelgegkattahdlsgklgtpkkeinrvlyslakkgklqkeagtpplwkia

Timeline for d2gxba2:

• d2gxba2 first appeared in SCOP 1.73, called d2gxba1
  
• d2gxba2 was called d2gxba_ in SCOPe 2.05
  
• d2gxba2 appears in SCOPe 2.07
  
• d2gxba2 appears in the current release, SCOPe 2.08