Lineage for d2gwka1 (2gwk A:5-147)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1857400Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1857401Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1858517Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1858518Protein automated matches [226839] (49 species)
    not a true protein
  7. 1858889Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)
  8. 1858893Domain d2gwka1: 2gwk A:5-147 [135809]
    Other proteins in same PDB: d2gwka2, d2gwkb2
    automated match to d1lcua1
    complexed with atp, ca

Details for d2gwka1

PDB Entry: 2gwk (more details), 2 Å

PDB Description: SpvB ADP-ribosylated actin: orthorhombic crystal form
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2gwka1:

Sequence, based on SEQRES records: (download)

>d2gwka1 c.55.1.0 (A:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasgr

Sequence, based on observed residues (ATOM records): (download)

>d2gwka1 c.55.1.0 (A:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhkdsyvgdeaqskrgiltlkypieh
giitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamy
vaiqavlslyasgr

SCOPe Domain Coordinates for d2gwka1:

Click to download the PDB-style file with coordinates for d2gwka1.
(The format of our PDB-style files is described here.)

Timeline for d2gwka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gwka2