SCOPe 2.05: Domain d2gwkb1: 2gwk B:5-147

Lineage for d2gwkb1 (2gwk B:5-147)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225907] (8 PDB entries)

8. Domain d2gwkb1: 2gwk B:5-147 [135811]
   Other proteins in same PDB: d2gwka2, d2gwkb2
   automated match to d1lcua1
   complexed with atp, ca

Details for d2gwkb1

PDB Entry: 2gwk, 2 Å

PDB Description: SpvB ADP-ribosylated actin: orthorhombic crystal form

PDB Compounds: (B:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2gwkb1:

Sequence, based on SEQRES records:

>d2gwkb1 c.55.1.0 (B:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasgr

Sequence, based on observed residues (ATOM records):

>d2gwkb1 c.55.1.0 (B:5-147) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmkdsyvgdeaqskrgiltlky
piehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnv
pamyvaiqavlslyasgr

Timeline for d2gwkb1:

• d2gwkb1 first appeared in SCOP 1.73
  
• d2gwkb1 appears in SCOPe 2.04
  
• d2gwkb1 appears in SCOPe 2.06
  
• d2gwkb1 appears in the current release, SCOPe 2.08