Lineage for d2gwja1 (2gwj A:5-146)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1171250Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1171251Superfamily c.55.1: Actin-like ATPase domain [53067] (14 families) (S)
    duplication contains two domains of this fold
  5. 1171252Family c.55.1.1: Actin/HSP70 [53068] (7 proteins)
  6. 1171253Protein Actin [53073] (6 species)
  7. 1171284Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [53075] (41 PDB entries)
    Uniprot P02568 ! SQ 02568
  8. 1171309Domain d2gwja1: 2gwj A:5-146 [135807]
    automatically matched to d1hlua1
    complexed with atp, ca

Details for d2gwja1

PDB Entry: 2gwj (more details), 1.9 Å

PDB Description: spvb adp-ribosylated actin: hexagonal crystal form
PDB Compounds: (A:) Actin, alpha skeletal muscle

SCOPe Domain Sequences for d2gwja1:

Sequence, based on SEQRES records: (download)

>d2gwja1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprhqgvmvgmgqkdsyvgdeaqskrgi
ltlkypiehgiitnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimf
etfnvpamyvaiqavlslyasg

Sequence, based on observed residues (ATOM records): (download)

>d2gwja1 c.55.1.1 (A:5-146) Actin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ttalvcdngsglvkagfagddapravfpsivgrprdsyvgdeaqskrgiltlkypiehgi
itnwddmekiwhhtfynelrvapeehptllteaplnpkanrekmtqimfetfnvpamyva
iqavlslyasg

SCOPe Domain Coordinates for d2gwja1:

Click to download the PDB-style file with coordinates for d2gwja1.
(The format of our PDB-style files is described here.)

Timeline for d2gwja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2gwja2