![]() | Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
![]() | Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
![]() | Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) ![]() duplication contains two domains of this fold |
![]() | Family c.55.1.10: ROK [110636] (8 proteins) Pfam PF00480 |
![]() | Protein Hypothetical protein SP2142 [142477] (1 species) |
![]() | Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142478] (1 PDB entry) Uniprot Q97NB0 1-114! Uniprot Q97NB0 115-289 |
![]() | Domain d2gupa1: 2gup A:1-114 [135744] complexed with suc, trs |
PDB Entry: 2gup (more details), 2.01 Å
SCOPe Domain Sequences for d2gupa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]} mtiatidiggtgikfasltpdgkildktsistpenledllawldqrlseqdysgiamsvp gavnqetgvidgfsavpyihgfswyealssyqlpvhlendancvglsellahpe
Timeline for d2gupa1: