SCOPe 2.08: Domain d2gupa1: 2gup A:1-114

Lineage for d2gupa1 (2gup A:1-114)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.10: ROK [110636] (8 proteins)
   Pfam PF00480

6. Protein Hypothetical protein SP2142 [142477] (1 species)

7. Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [142478] (1 PDB entry)
   Uniprot Q97NB0 1-114! Uniprot Q97NB0 115-289

8. Domain d2gupa1: 2gup A:1-114 [135744]
   complexed with trs

Details for d2gupa1

PDB Entry: 2gup, 2.01 Å

PDB Description: structural genomics, the crystal structure of a rok family protein from streptococcus pneumoniae tigr4 in complex with sucrose

PDB Compounds: (A:) ROK family protein

SCOPe Domain Sequences for d2gupa1:

Sequence; same for both SEQRES and ATOM records:

>d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
mtiatidiggtgikfasltpdgkildktsistpenledllawldqrlseqdysgiamsvp
gavnqetgvidgfsavpyihgfswyealssyqlpvhlendancvglsellahpe

Timeline for d2gupa1:

• d2gupa1 first appeared in SCOP 1.73
  
• d2gupa1 appears in SCOPe 2.07