Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (34 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.32: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144276] (1 family) |
Family h.1.32.1: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144277] (3 proteins) |
Protein Hemoglobin linker chain l1 [144282] (1 species) |
Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144283] (1 PDB entry) Uniprot Q9GV76 24-84 |
Domain d2gtlm3: 2gtl M:9-59 [135669] Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3 complexed with ca, cmo, hem, zn |
PDB Entry: 2gtl (more details), 3.5 Å
SCOPe Domain Sequences for d2gtlm3:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gtlm3 h.1.32.1 (M:9-59) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]} rfqylvknqnlhidylakklhdieeeynklthdvdkktirqlkarisnlee
Timeline for d2gtlm3: