SCOPe 2.01: Domain d2gtlm3: 2gtl M:9-59

Lineage for d2gtlm3 (2gtl M:9-59)

1. Root: SCOPe 2.01

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.32: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144276] (1 family)

5. Family h.1.32.1: Heterotrimerisation domain of extracellular hemoglobin linker subunits [144277] (3 proteins)

6. Protein Hemoglobin linker chain l1 [144282] (1 species)

7. Species Common earthworm (Lumbricus terrestris) [TaxId:6398] [144283] (1 PDB entry)
   Uniprot Q9GV76 24-84

8. Domain d2gtlm3: 2gtl M:9-59 [135669]
   Other proteins in same PDB: d2gtla1, d2gtlb1, d2gtlc1, d2gtld1, d2gtle1, d2gtlf1, d2gtlg1, d2gtlh1, d2gtli1, d2gtlj1, d2gtlk1, d2gtll1, d2gtlm1, d2gtlm2, d2gtln1, d2gtln2, d2gtln3, d2gtlo1, d2gtlo2, d2gtlo3
   complexed with ca, cmo, hem, zn

Details for d2gtlm3

PDB Entry: 2gtl, 3.5 Å

PDB Description: Lumbricus Erythrocruorin at 3.5A resolution

PDB Compounds: (M:) Hemoglobin linker chain L1

SCOPe Domain Sequences for d2gtlm3:

Sequence; same for both SEQRES and ATOM records:

>d2gtlm3 h.1.32.1 (M:9-59) Hemoglobin linker chain l1 {Common earthworm (Lumbricus terrestris) [TaxId: 6398]}
rfqylvknqnlhidylakklhdieeeynklthdvdkktirqlkarisnlee

Timeline for d2gtlm3:

• d2gtlm3 first appeared in SCOP 1.73
  
• d2gtlm3 appears in SCOP 1.75
  
• d2gtlm3 appears in SCOPe 2.02
  
• d2gtlm3 appears in the current release, SCOPe 2.08