SCOPe 2.08: Domain d2gt3a_: 2gt3 A:

Lineage for d2gt3a_ (2gt3 A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins)

6. Protein automated matches [194683] (3 species)
   not a true protein

7. Species Escherichia coli [TaxId:562] [255193] (1 PDB entry)

8. Domain d2gt3a_: 2gt3 A: [135623]
   automated match to d1ff3a_

Details for d2gt3a_

PDB Entry: 2gt3

PDB Description: solution structure and dynamics of the reduced form of methionine sulfoxide reductase a from escherichia coli, a 23 kda protein

PDB Compounds: (A:) Methionine Sulfoxide Reductase A

SCOPe Domain Sequences for d2gt3a_:

Sequence; same for both SEQRES and ATOM records:

>d2gt3a_ d.58.28.1 (A:) automated matches {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknpygycgiggigvclppea

Timeline for d2gt3a_:

• d2gt3a_ first appeared in SCOP 1.73, called d2gt3a1
  
• d2gt3a_ appears in SCOPe 2.07