![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
![]() | Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (2 families) ![]() common fold is elaborated with additional secondary structures |
![]() | Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (2 proteins) |
![]() | Protein automated matches [194683] (3 species) not a true protein |
![]() | Species Escherichia coli [TaxId:562] [255193] (1 PDB entry) |
![]() | Domain d2gt3a_: 2gt3 A: [135623] automated match to d1ff3a_ |
PDB Entry: 2gt3 (more details)
SCOPe Domain Sequences for d2gt3a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gt3a_ d.58.28.1 (A:) automated matches {Escherichia coli [TaxId: 562]} slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy yaeddhqqylhknpygycgiggigvclppea
Timeline for d2gt3a_: