Lineage for d2gt3a1 (2gt3 A:1-211)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 723373Fold d.58: Ferredoxin-like [54861] (55 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 725651Superfamily d.58.28: Peptide methionine sulfoxide reductase [55068] (1 family) (S)
    common fold is elaborated with additional secondary structures
  5. 725652Family d.58.28.1: Peptide methionine sulfoxide reductase [55069] (1 protein)
  6. 725653Protein Peptide methionine sulfoxide reductase [55070] (3 species)
  7. 725658Species Escherichia coli [TaxId:562] [55072] (2 PDB entries)
  8. 725662Domain d2gt3a1: 2gt3 A:1-211 [135623]
    automatically matched to d1ff3a_

Details for d2gt3a1

PDB Entry: 2gt3 (more details)

PDB Description: Solution structure and dynamics of the reduced form of Methionine Sulfoxide Reductase A from Escherichia coli, a 23 kDa protein
PDB Compounds: (A:) Methionine Sulfoxide Reductase A

SCOP Domain Sequences for d2gt3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gt3a1 d.58.28.1 (A:1-211) Peptide methionine sulfoxide reductase {Escherichia coli [TaxId: 562]}
slfdkkhlvspadalpgrntpmpvatlhavnghsmtnvpdgmeiaifamgcfwgverlfw
qlpgvystaagytggytpnptyrevcsgdtghaeavrivydpsvisyeqllqvfwenhdp
aqgmrqgndhgtqyrsaiypltpeqdaaaraslerfqaamlaadddrhitteianatpfy
yaeddhqqylhknpygycgiggigvclppea

SCOP Domain Coordinates for d2gt3a1:

Click to download the PDB-style file with coordinates for d2gt3a1.
(The format of our PDB-style files is described here.)

Timeline for d2gt3a1: