SCOPe 2.01: Domain d2gsmd1: 2gsm D:130-281

Lineage for d2gsmd1 (2gsm D:130-281)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (2 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Rhodobacter sphaeroides [TaxId:1063] [74870] (4 PDB entries)

8. Domain d2gsmd1: 2gsm D:130-281 [135593]
   Other proteins in same PDB: d2gsma_, d2gsmb2, d2gsmc_, d2gsmd2
   automatically matched to d1m56b1
   complexed with ca, cd, cu, dmu, hea, mg, oh, trd

Details for d2gsmd1

PDB Entry: 2gsm, 2 Å

PDB Description: catalytic core (subunits i and ii) of cytochrome c oxidase from rhodobacter sphaeroides

PDB Compounds: (D:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d2gsmd1:

Sequence; same for both SEQRES and ATOM records:

>d2gsmd1 b.6.1.2 (D:130-281) Cytochrome c oxidase {Rhodobacter sphaeroides [TaxId: 1063]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq

Timeline for d2gsmd1:

• d2gsmd1 first appeared in SCOP 1.73
  
• d2gsmd1 appears in SCOP 1.75
  
• d2gsmd1 appears in SCOPe 2.02
  
• d2gsmd1 appears in the current release, SCOPe 2.08